Kostenloser Versand ab €200

Sermorelin

10mg

❄️Lyophilized powder

€59.99
1

Rabatt pro Menge

MengeRabattPreis pro Einheit
5 - 1010%€53.99
11 - 2015%€50.99
21+20%€47.99

Strenge Tests durch unabhängige Labore

Jede Charge unserer Forschungschemikalien und Peptide wird von einem unabhängigen Labor auf Reinheit und Identität geprüft.

Gesamt: €59.99

Kaufen Sie & sammeln Sie 60 Punkte!

For laboratory research use only by qualified professionals. Not for human or veterinary use. Not for ingestion, injection, topical application, diagnostic, therapeutic, prophylactic or cosmetic use.

Sermorelin is supplied as a catalogued research material in 10 mg. It is intended only for controlled analytical, biochemical and non-clinical laboratory workflows. The catalogue amount identifies the nominal vial presentation; it is not a dose or a use instruction.

Sermorelin is the C-terminally amidated 1–29 fragment of human growth-hormone-releasing hormone. The free peptide and acetate or hydrated materials have different formula treatment; C-terminal amidation and exact counter-ion must be confirmed from the batch identity record [1,2].

Product identity

Identity must be assigned to the exact batch rather than to a marketed name alone. Sequence, terminal modifications, conjugation, salt or counter-ion, hydration state and excipients may change the applicable mass and registry identifiers. The batch CoA and SDS take precedence over literature identifiers shown below.

Chemical properties and registry information

PropertyValue
Name and synonymsSermorelin; GRF(1–29)-NH₂; GHRH(1–29)-NH₂
Material categorySynthetic GHRH-fragment research peptide
Sequence or structural definitionH-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Molecular formulaC149H246N44O42S for the free peptide; acetate and hydrates differ
Average molecular mass3357.9 g/mol for the free peptide
CAS Registry Number86168-78-7 for the free peptide; CAS 114466-38-5 is associated with sermorelin acetate
PubChem CIDCID 16132413 for the free peptide, conditional on exact-form confirmation
Structural featuresNative human GRF residues 1–29 with a C-terminal amide
Physical formCatalogue vial; the exact physical state, salt or counter-ion and excipients are batch-specific and must be verified in the CoA and SDS.
Catalogue presentations10 mg
Batch identity and quality documentationLot-specific identity and available analytical reports must be verified against the CoA entry associated with the exact product size and batch.
Intended useAnalytical, biochemical and non-clinical laboratory research only; all human and veterinary uses are excluded.

Where an identifier is qualified or omitted, no unambiguous exact-form public assignment has been confirmed. Do not transfer an identifier from a related analogue, salt, conjugate or formulation.

Research context and evidence status

What the literature supports

Appropriate research contexts include GHRH-receptor binding and signalling, primary pituitary-cell assays, peptide-fragment structure–activity studies and analytical separation from modified GHRH analogues [1–3].

Evidence limitations

Historical medicinal-product or human-study information does not authenticate this catalogue material and must not be converted into efficacy, dosing or suitability claims. GHRH analogues with substitutions or acylation are not interchangeable with sermorelin.

Sermorelin has a history as a medicinal active substance. Substance-specific and provider eligibility require review beyond RUO labeling.

ImportantResearch-use labeling does not itself determine the substance-specific legal status. The purchaser is responsible for confirming institutional authorization, local restrictions and lawful procurement, possession, import, export, storage and disposal.

Technical comparison

The comparison below is limited to structural and analytical distinctions. It does not compare clinical performance or recommend a use.

AspectThis catalogue materialComparator
IdentitySermorelin: unmodified human GRF(1–29)-NH₂ sequenceTesamorelin or CJC no-DAC, which contain acylation, length or residue substitutions
Structural distinction29 native GRF residues and a C-terminal amideDifferent exact primary structure and/or N-terminal modification
Analytical implicationConfirm C-terminal amide, sulfur-containing sequence and counter-ionRequires a separate exact-form reference standard
What is not impliedNo conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability.No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability.

Quality and batch documentation

Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.

Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.

Laboratory handling and storage

Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.

This page intentionally provides no reconstitution, administration or dosing instructions. Laboratory preparation, analytical method selection, risk assessment, personal protective equipment and waste disposal must be defined by the qualified institution and the applicable SDS.

Regulatory and legal status

This catalogue material is not offered as a medicine, medical device, in-vitro diagnostic, food, dietary supplement, cosmetic or veterinary product. It is not intended to diagnose, treat, cure, mitigate or prevent any disease or condition.

A research designation does not override medicinal-product, controlled-substance, chemical, customs or other substance-specific rules. Availability may be restricted by jurisdiction and by the purchaser's verified professional or institutional status.

Sources and references

References document identity and research context only. They do not constitute instructions for use or evidence that this catalogue batch is suitable for any human or veterinary purpose.

  1. [1] PubChem. Sermorelin compound record.
  2. [2] FDA GSRS. Sermorelin acetate substance record.
  3. [3] Primary pituitary-cell study of GRF fragments. Biochemical and Biophysical Research Communications (1984).

Frequently Asked Questions

What is this material intended for?

Controlled laboratory research by qualified professionals, including substantiated analytical, biochemical or non-clinical workflows. It is not intended for personal use.

Is the amount shown on the vial a dosage?

No. It is a nominal catalogue presentation used to identify the product variant. It is not a dose, concentration, administration schedule or preparation instruction.

Do the CAS number and PubChem CID apply to every batch form?

Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.

What does an analytical purity result mean?

It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.

How should the material be stored and handled?

Follow the exact label, batch CoA and SDS, together with the institution's risk assessment. This page does not provide reconstitution or administration guidance.

May this material be used in humans or animals?

No. Human and veterinary use, including ingestion, injection, topical application, diagnosis, treatment, prevention and cosmetic use, is expressly excluded.

RESEARCH USE ONLY. NOT FOR HUMAN OR VETERINARY USE. THE PRODUCT NAME, VIAL AMOUNT AND LITERATURE REFERENCES MUST NOT BE INTERPRETED AS A DOSAGE, ADMINISTRATION INSTRUCTION OR MEDICAL CLAIM.

LABORATORY RESEARCH MATERIAL — FOR QUALIFIED PROFESSIONAL USE ONLY

For analytical, biochemical or non-clinical laboratory research only. Not for human or veterinary use. Not for ingestion, injection, topical application, inhalation, diagnostic, therapeutic, prophylactic or cosmetic use.

Research-use restrictions

Mandatory conditions:

  • Restricted to qualified professionals acting for verified laboratories, universities, companies or other research institutions.
  • The product name and nominal catalogue presentation are identifiers; they are not a dose, concentration, preparation protocol, ingestion instruction or administration instruction.
  • Before laboratory work, verify the exact material identity, sequence or structure, physical form, fill, salt or counter-ion, lot number and matching CoA and SDS.
  • Storage, handling, PPE, exposure response and disposal must follow the exact label, batch documentation, SDS and an institution-approved risk assessment.
  • The purchaser is responsible for institutional authorization and for jurisdiction-specific rules governing procurement, import, export, possession, storage and disposal.
  • Keep secured, correctly identified and inaccessible to children and all unauthorized persons.