
1mg
❄️Lyophilized powder
Rabatt pro Menge
| Menge | Rabatt | Preis pro Einheit |
|---|---|---|
| 5 - 10 | 10% | €89.10 |
| 11 - 20 | 15% | €84.15 |
| 21+ | 20% | €79.20 |
Strenge Tests durch unabhängige Labore
Jede Charge unserer Forschungschemikalien und Peptide wird von einem unabhängigen Labor auf Reinheit und Identität geprüft.
Gesamt: €99.00
For laboratory research use only by qualified professionals. Not for human or veterinary use. Not for ingestion, injection, topical application, diagnostic, therapeutic, prophylactic or cosmetic use.
IGF-1 LR3 is supplied as a catalogued research material in 1 mg. It is intended only for controlled analytical, biochemical and non-clinical laboratory workflows. The catalogue amount identifies the nominal vial presentation; it is not a dose or a use instruction.
IGF-1 LR3 is not native IGF-I. The catalogue identity is conditional on an 83-residue Long Arg3 construct with the stated extension and Arg3 substitution; supplier naming alone cannot establish sequence, folding or recombinant form.
Identity must be assigned to the exact batch rather than to a marketed name alone. Sequence, terminal modifications, conjugation, salt or counter-ion, hydration state and excipients may change the applicable mass and registry identifiers. The batch CoA and SDS take precedence over literature identifiers shown below.
| Property | Value |
|---|---|
| Name and synonyms | Long Arg3 IGF-I; Long R3 IGF-I; IGF-1 LR3 |
| Material category | Engineered long-form insulin-like growth factor-I analogue; 83-amino-acid protein |
| Sequence or structural definition | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular formula | Not assigned here: an exact-form formula requires confirmed sequence, disulfide state, termini and batch composition |
| Average molecular mass | Approximately 9.1 kDa; confirm the intact mass for the exact batch |
| CAS Registry Number | Not assigned here: public supplier records are inconsistent and do not establish the exact recombinant form |
| PubChem CID | No unambiguous exact-form PubChem CID confirmed |
| Structural features | Thirteen-residue N-terminal extension (MFPAMPLSSLFVN) plus Glu-to-Arg substitution at position 3 of the IGF-I domain; disulfide state and expression-derived heterogeneity require batch confirmation |
| Physical form | Catalogue vial; the exact physical state, salt or counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
| Catalogue presentations | 1 mg |
| Batch identity and quality documentation | Lot-specific identity and available analytical reports must be verified against the CoA entry associated with the exact product size and batch. |
| Intended use | Analytical, biochemical and non-clinical laboratory research only; all human and veterinary uses are excluded. |
Where an identifier is qualified or omitted, no unambiguous exact-form public assignment has been confirmed. Do not transfer an identifier from a related analogue, salt, conjugate or formulation.
Long R3 IGF-I has been examined in biochemical and cell-based systems as an engineered IGF-I analogue with altered interaction with IGF-binding proteins. Structural and signalling observations are construct-, matrix- and assay-dependent.
The cited work does not authenticate this catalogue batch or establish human-use outcomes. Data for native IGF-I, des(1-3)-IGF-I, another LR3 construct or a differently folded preparation are not automatically applicable.
This engineered growth-factor analogue requires enhanced legal, platform and payment-provider review. The page must remain limited to exact chemical identity, analytical controls and non-clinical literature context and must not imply medicinal equivalence or consumer suitability.
| Important | Research-use labeling does not itself determine the substance-specific legal status. The purchaser is responsible for confirming institutional authorization, local restrictions and lawful procurement, possession, import, export, storage and disposal. |
The comparison below is limited to structural and analytical distinctions. It does not compare clinical performance or recommend a use.
| Aspect | This catalogue material | Comparator |
|---|---|---|
| Identity | Conditional 83-residue Long Arg3 IGF-I construct | Native mature human IGF-I: 70 residues |
| Structural distinction | Carries a 13-residue N-terminal extension and an E3R substitution in the IGF-I domain | Native IGF-I lacks both changes; des(1-3)-IGF-I is a separate truncated analogue |
| Analytical implication | Require intact LC-MS, peptide mapping, disulfide assessment, purity and aggregate analysis for the exact batch | A nominal mass or supplier label cannot distinguish LR3 from native, truncated or sequence-divergent material |
| What is not implied | No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability. | No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability. |
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.
This page intentionally provides no reconstitution, administration or dosing instructions. Laboratory preparation, analytical method selection, risk assessment, personal protective equipment and waste disposal must be defined by the qualified institution and the applicable SDS.
This catalogue material is not offered as a medicine, medical device, in-vitro diagnostic, food, dietary supplement, cosmetic or veterinary product. It is not intended to diagnose, treat, cure, mitigate or prevent any disease or condition.
A research designation does not override medicinal-product, controlled-substance, chemical, customs or other substance-specific rules. Availability may be restricted by jurisdiction and by the purchaser's verified professional or institutional status.
References document identity and research context only. They do not constitute instructions for use or evidence that this catalogue batch is suitable for any human or veterinary purpose.
Controlled laboratory research by qualified professionals, including substantiated analytical, biochemical or non-clinical workflows. It is not intended for personal use.
No. It is a nominal catalogue presentation used to identify the product variant. It is not a dose, concentration, administration schedule or preparation instruction.
Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.
It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.
Follow the exact label, batch CoA and SDS, together with the institution's risk assessment. This page does not provide reconstitution or administration guidance.
No. Human and veterinary use, including ingestion, injection, topical application, diagnosis, treatment, prevention and cosmetic use, is expressly excluded.
RESEARCH USE ONLY. NOT FOR HUMAN OR VETERINARY USE. THE PRODUCT NAME, VIAL AMOUNT AND LITERATURE REFERENCES MUST NOT BE INTERPRETED AS A DOSAGE, ADMINISTRATION INSTRUCTION OR MEDICAL CLAIM.
For analytical, biochemical or non-clinical laboratory research only. Not for human or veterinary use. Not for ingestion, injection, topical application, inhalation, diagnostic, therapeutic, prophylactic or cosmetic use.