
5mg
❄️Lyophilized powder
Rabatt pro Menge
| Menge | Rabatt | Preis pro Einheit |
|---|---|---|
| 5 - 10 | 10% | €53.99 |
| 11 - 20 | 15% | €50.99 |
| 21+ | 20% | €47.99 |
Strenge Tests durch unabhängige Labore
Jede Charge unserer Forschungschemikalien und Peptide wird von einem unabhängigen Labor auf Reinheit und Identität geprüft.
Gesamt: €59.99
For laboratory research use only by qualified professionals. Not for human or veterinary use. Not for ingestion, injection, topical application, diagnostic, therapeutic, prophylactic or cosmetic use.
Cagrilintide is supplied as a catalogued research material in 5 mg. It is intended only for controlled analytical, biochemical and non-clinical laboratory workflows. The catalogue amount identifies the nominal vial presentation; it is not a dose or a use instruction.
Cagrilintide is a structurally complex 37-residue peptide whose identity depends on sequence, disulfide connectivity, C-terminal amidation and the intact Lys-linked lipid conjugate. Registry data apply only when all of those features and the supplied form match [1–3].
Identity must be assigned to the exact batch rather than to a marketed name alone. Sequence, terminal modifications, conjugation, salt or counter-ion, hydration state and excipients may change the applicable mass and registry identifiers. The batch CoA and SDS take precedence over literature identifiers shown below.
| Property | Value |
|---|---|
| Name and synonyms | Cagrilintide; long-acting acylated amylin analogue |
| Material category | Synthetic 37-residue, lipidated amylin-analogue research peptide |
| Sequence or structural definition | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 |
| Molecular formula | C194H312N54O59S2 for the defined free acylated peptide; salts and solvates differ. |
| Average molecular mass | 4409.0 g/mol average mass for the defined free acylated peptide. |
| CAS Registry Number | 1415456-99-3 for defined cagrilintide, conditional on exact-structure and form confirmation. |
| PubChem CID | CID 171397054 for defined cagrilintide, conditional on exact-structure and form confirmation. |
| Structural features | Cys2–Cys7 disulfide; C-terminal amide; Lys1 lipidated through γ-glutamyl to a C20 fatty diacid. |
| Physical form | Catalogue vial; the exact physical state, salt or counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
| Catalogue presentations | 5 mg |
| Batch identity and quality documentation | Lot-specific identity and available analytical reports must be verified against the CoA entry associated with the exact product size and batch. |
| Intended use | Analytical, biochemical and non-clinical laboratory research only; all human and veterinary uses are excluded. |
Where an identifier is qualified or omitted, no unambiguous exact-form public assignment has been confirmed. Do not transfer an identifier from a related analogue, salt, conjugate or formulation.
Cagrilintide has been characterized as an investigational long-acting amylin analogue in structural, pharmacological and controlled clinical research [2–4].
Published phase 2 observations concern a separately manufactured investigational drug and do not establish authorization, batch equivalence, safety or efficacy for this catalogue material [4].
The active catalogue mapping supplied for this update identifies a 5 mg presentation even though the internal product ID contains “10mg”; the visible label and matching CoA must govern.
| Important | Research-use labeling does not itself determine the substance-specific legal status. The purchaser is responsible for confirming institutional authorization, local restrictions and lawful procurement, possession, import, export, storage and disposal. |
The comparison below is limited to structural and analytical distinctions. It does not compare clinical performance or recommend a use.
| Aspect | This catalogue material | Comparator |
|---|---|---|
| Identity | Defined lipidated cagrilintide structure, subject to complete batch confirmation | Unmodified human amylin peptide |
| Structural distinction | Sequence substitutions, Lys-linked C20 lipid conjugate, disulfide and C-terminal amide | Native amylin sequence without the cagrilintide lipid conjugate |
| Analytical implication | Confirm intact conjugate mass, lipid attachment, sequence, termini and disulfide connectivity | Native-peptide methods and identifiers do not establish the acylated analogue's identity |
| What is not implied | No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability. | No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability. |
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.
This page intentionally provides no reconstitution, administration or dosing instructions. Laboratory preparation, analytical method selection, risk assessment, personal protective equipment and waste disposal must be defined by the qualified institution and the applicable SDS.
This catalogue material is not offered as a medicine, medical device, in-vitro diagnostic, food, dietary supplement, cosmetic or veterinary product. It is not intended to diagnose, treat, cure, mitigate or prevent any disease or condition.
A research designation does not override medicinal-product, controlled-substance, chemical, customs or other substance-specific rules. Availability may be restricted by jurisdiction and by the purchaser's verified professional or institutional status.
References document identity and research context only. They do not constitute instructions for use or evidence that this catalogue batch is suitable for any human or veterinary purpose.
Controlled laboratory research by qualified professionals, including substantiated analytical, biochemical or non-clinical workflows. It is not intended for personal use.
No. It is a nominal catalogue presentation used to identify the product variant. It is not a dose, concentration, administration schedule or preparation instruction.
Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.
It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.
Follow the exact label, batch CoA and SDS, together with the institution's risk assessment. This page does not provide reconstitution or administration guidance.
No. Human and veterinary use, including ingestion, injection, topical application, diagnosis, treatment, prevention and cosmetic use, is expressly excluded.
RESEARCH USE ONLY. NOT FOR HUMAN OR VETERINARY USE. THE PRODUCT NAME, VIAL AMOUNT AND LITERATURE REFERENCES MUST NOT BE INTERPRETED AS A DOSAGE, ADMINISTRATION INSTRUCTION OR MEDICAL CLAIM.
For analytical, biochemical or non-clinical laboratory research only. Not for human or veterinary use. Not for ingestion, injection, topical application, inhalation, diagnostic, therapeutic, prophylactic or cosmetic use.