
5mg
❄️Lyophilized powder
Rabatt pro Menge
| Menge | Rabatt | Preis pro Einheit |
|---|---|---|
| 5 - 10 | 10% | €40.49 |
| 11 - 20 | 15% | €38.24 |
| 21+ | 20% | €35.99 |
Strenge Tests durch unabhängige Labore
Jede Charge unserer Forschungschemikalien und Peptide wird von einem unabhängigen Labor auf Reinheit und Identität geprüft.
Gesamt: €44.99
For laboratory research use only by qualified professionals. Not for human or veterinary use. Not for ingestion, injection, topical application, diagnostic, therapeutic, prophylactic or cosmetic use.
LL-37 is supplied as a catalogued research material in 5 mg. It is intended only for controlled analytical, biochemical and non-clinical laboratory workflows. The catalogue amount identifies the nominal vial presentation; it is not a dose or a use instruction.
The assigned identity is the human 37-residue CAMP-derived peptide with free termini. Shorter cathelicidin fragments, scrambled LL-37 controls, terminally modified analogues and salt forms are distinct materials.
Identity must be assigned to the exact batch rather than to a marketed name alone. Sequence, terminal modifications, conjugation, salt or counter-ion, hydration state and excipients may change the applicable mass and registry identifiers. The batch CoA and SDS take precedence over literature identifiers shown below.
| Property | Value |
|---|---|
| Name and synonyms | LL-37; human cathelicidin antimicrobial peptide; CAMP-derived 37-mer |
| Material category | Human cathelicidin-derived cationic peptide; 37 amino acids |
| Sequence or structural definition | [LL-37, 37 aa] |
| Molecular formula | C205H340N60O53 |
| Average molecular mass | Approximately 4,493 Da for the neutral free peptide; batch salt and hydration can change measured mass |
| CAS Registry Number | 154947-66-7 is widely used for LL-37 but is also reused across salt forms; verify exact applicability |
| PubChem CID | CID 134611881 (human LL-37 record); related public records may represent different forms |
| Structural features | Unmodified 37-residue human sequence with free termini in the assigned structure; counter-ion, hydration and aggregation state are batch-specific |
| Physical form | Catalogue vial; the exact physical state, salt or counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
| Catalogue presentations | 5 mg |
| Batch identity and quality documentation | Lot-specific identity and available analytical reports must be verified against the CoA entry associated with the exact product size and batch. |
| Intended use | Analytical, biochemical and non-clinical laboratory research only; all human and veterinary uses are excluded. |
Where an identifier is qualified or omitted, no unambiguous exact-form public assignment has been confirmed. Do not transfer an identifier from a related analogue, salt, conjugate or formulation.
LL-37 has been studied in vitro in membrane-interaction, microbial, innate-immune and cell-signalling systems. Its conformation and measured response vary strongly with ionic strength, matrix composition, peptide concentration and aggregation state.
The cited mechanistic studies do not authenticate this batch or establish human-use outcomes. Results are highly model- and condition-dependent and cannot be transferred between LL-37, precursor hCAP18, fragments or modified analogues.
LL-37 is a high-risk marketed research peptide with no medicinal equivalence established by this catalogue identity. Market-specific legal, advertising, customs, platform and payment-provider review is required before publication or sale.
| Important | Research-use labeling does not itself determine the substance-specific legal status. The purchaser is responsible for confirming institutional authorization, local restrictions and lawful procurement, possession, import, export, storage and disposal. |
The comparison below is limited to structural and analytical distinctions. It does not compare clinical performance or recommend a use.
| Aspect | This catalogue material | Comparator |
|---|---|---|
| Identity | Mature human LL-37 sequence, 37 residues | hCAP18: longer human cathelicidin precursor from which LL-37 is proteolytically released |
| Structural distinction | Defined C-terminal 37-residue processed peptide | hCAP18 includes an N-terminal cathelin domain and is not analytically interchangeable with LL-37 |
| Analytical implication | Confirm intact mass, sequence, purity, terminal form, counter-ion and aggregation profile | Functional assay overlap cannot distinguish full-length LL-37 from fragments, scrambled controls or aggregates |
| What is not implied | No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability. | No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability. |
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.
This page intentionally provides no reconstitution, administration or dosing instructions. Laboratory preparation, analytical method selection, risk assessment, personal protective equipment and waste disposal must be defined by the qualified institution and the applicable SDS.
This catalogue material is not offered as a medicine, medical device, in-vitro diagnostic, food, dietary supplement, cosmetic or veterinary product. It is not intended to diagnose, treat, cure, mitigate or prevent any disease or condition.
A research designation does not override medicinal-product, controlled-substance, chemical, customs or other substance-specific rules. Availability may be restricted by jurisdiction and by the purchaser's verified professional or institutional status.
References document identity and research context only. They do not constitute instructions for use or evidence that this catalogue batch is suitable for any human or veterinary purpose.
Controlled laboratory research by qualified professionals, including substantiated analytical, biochemical or non-clinical workflows. It is not intended for personal use.
No. It is a nominal catalogue presentation used to identify the product variant. It is not a dose, concentration, administration schedule or preparation instruction.
Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.
It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.
Follow the exact label, batch CoA and SDS, together with the institution's risk assessment. This page does not provide reconstitution or administration guidance.
No. Human and veterinary use, including ingestion, injection, topical application, diagnosis, treatment, prevention and cosmetic use, is expressly excluded.
RESEARCH USE ONLY. NOT FOR HUMAN OR VETERINARY USE. THE PRODUCT NAME, VIAL AMOUNT AND LITERATURE REFERENCES MUST NOT BE INTERPRETED AS A DOSAGE, ADMINISTRATION INSTRUCTION OR MEDICAL CLAIM.
For analytical, biochemical or non-clinical laboratory research only. Not for human or veterinary use. Not for ingestion, injection, topical application, inhalation, diagnostic, therapeutic, prophylactic or cosmetic use.