
10mg
❄️Lyophilized powder
Rabatt pro Menge
| Menge | Rabatt | Preis pro Einheit |
|---|---|---|
| 5 - 10 | 10% | €107.10 |
| 11 - 20 | 15% | €101.15 |
| 21+ | 20% | €95.20 |
Strenge Tests durch unabhängige Labore
Jede Charge unserer Forschungschemikalien und Peptide wird von einem unabhängigen Labor auf Reinheit und Identität geprüft.
Gesamt: €119.00
For laboratory research use only by qualified professionals. Not for human or veterinary use. Not for ingestion, injection, topical application, diagnostic, therapeutic, prophylactic or cosmetic use.
FOXO4 is supplied as a catalogued research material in 10mg. It is intended only for controlled analytical, biochemical and non-clinical laboratory workflows. The catalogue amount identifies the nominal vial presentation; it is not a dose or a use instruction.
“FOXO4” alone could denote the endogenous protein, a protein fragment, or the FOXO4-DRI peptide reported in the literature. The public catalogue context appears to intend FOXO4-DRI, but the full all-D sequence, TAT segment, termini and salt must be verified before exact registry fields are assigned [1–4].
Identity must be assigned to the exact batch rather than to a marketed name alone. Sequence, terminal modifications, conjugation, salt or counter-ion, hydration state and excipients may change the applicable mass and registry identifiers. The batch CoA and SDS take precedence over literature identifiers shown below.
| Property | Value |
|---|---|
| Name and synonyms | FOXO4 catalogue label; provisionally FOXO4-DRI if the batch confirms the reported 46-residue construct |
| Material category | Putative all-D retro-inverso cell-penetrating research peptide; exact construct unconfirmed |
| Sequence or structural definition | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (46 residues; all chiral residues reported as D; conditional on batch confirmation) |
| Molecular formula | No unconditional assignment; PubChem records C228H388N86O64 for parent FOXO4-DRI, subject to exact-construct and form confirmation |
| Average molecular mass | Approximately 5358.1 g/mol for the PubChem parent structure; acetate/counter-ion assemblies differ |
| CAS Registry Number | Not assigned here; no authoritative exact-form match to the catalogue batch was established |
| PubChem CID | Parent CID 167312269; a separate acetate assembly is CID 167312268; neither is assigned to the batch without confirmation |
| Structural features | Reported 46-residue retro-inverso design with D-configured chiral residues and an HIV-TAT-derived cell-penetrating segment; termini and counter-ion require confirmation |
| Physical form | Catalogue vial; the exact physical state, salt or counter-ion and excipients are batch-specific and must be verified in the CoA and SDS. |
| Catalogue presentations | 10mg |
| Batch identity and quality documentation | Lot-specific identity and available analytical reports must be verified against the CoA entry associated with the exact product size and batch. |
| Intended use | Analytical, biochemical and non-clinical laboratory research only; all human and veterinary uses are excluded. |
Where an identifier is qualified or omitted, no unambiguous exact-form public assignment has been confirmed. Do not transfer an identifier from a related analogue, salt, conjugate or formulation.
The originating FOXO4-DRI publication examined disruption of a FOXO4–p53 interaction in cultured cells and mouse models. It provides a preclinical research model and a defined structural hypothesis, not evidence for performance of the catalogue batch [1,2].
The cited work is preclinical. It does not establish human safety, efficacy, anti-ageing effects, recovery effects, dosage, administration, or medicine authorization. Results for the reported FOXO4-DRI construct cannot be transferred to a batch whose construct and salt are unconfirmed [1–4].
FOXO4-DRI is an experimental research construct, not an authorised medicinal product. The catalogue label must not imply equivalence to endogenous FOXO4 or suitability for human use.
| Important | Research-use labeling does not itself determine the substance-specific legal status. The purchaser is responsible for confirming institutional authorization, local restrictions and lawful procurement, possession, import, export, storage and disposal. |
The comparison below is limited to structural and analytical distinctions. It does not compare clinical performance or recommend a use.
| Aspect | This catalogue material | Comparator |
|---|---|---|
| Identity | Catalogue FOXO4, provisionally mapped to the reported 46-residue FOXO4-DRI peptide | Full-length endogenous human FOXO4 protein |
| Structural distinction | Short retro-inverso peptide with a cell-penetrating segment and reported D stereochemistry | Large naturally translated L-amino-acid transcription-factor protein |
| Analytical implication | Requires intact-mass, sequence, stereochemical, TAT-segment and counter-ion confirmation | Protein identity requires a different sequence, mass and analytical control set |
| What is not implied | No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability. | No conclusion about human or veterinary safety, efficacy, dosage, route, duration or interchangeability. |
Quality information is batch- and presentation-specific. Use only the report linked to the exact size and lot. A report listed for another size, lot or similarly named material must not be treated as evidence for this product.
Chromatographic area purity, identity, net peptide or analyte content, water or counter-ion content, sterility, endotoxin and elemental impurities are different measurements. One result does not establish the others. Only tests supported by a visible, matching report should be regarded as available.
Store and handle only under the conditions stated on the product label, batch CoA and SDS. Keep the container secured, correctly identified and protected from contamination. Do not infer storage, solvent compatibility or stability from a related compound.
This page intentionally provides no reconstitution, administration or dosing instructions. Laboratory preparation, analytical method selection, risk assessment, personal protective equipment and waste disposal must be defined by the qualified institution and the applicable SDS.
This catalogue material is not offered as a medicine, medical device, in-vitro diagnostic, food, dietary supplement, cosmetic or veterinary product. It is not intended to diagnose, treat, cure, mitigate or prevent any disease or condition.
A research designation does not override medicinal-product, controlled-substance, chemical, customs or other substance-specific rules. Availability may be restricted by jurisdiction and by the purchaser's verified professional or institutional status.
References document identity and research context only. They do not constitute instructions for use or evidence that this catalogue batch is suitable for any human or veterinary purpose.
Controlled laboratory research by qualified professionals, including substantiated analytical, biochemical or non-clinical workflows. It is not intended for personal use.
No. It is a nominal catalogue presentation used to identify the product variant. It is not a dose, concentration, administration schedule or preparation instruction.
Only when the exact sequence or structure, termini, conjugation, salt or counter-ion and hydration state match. The batch CoA and SDS govern; a related-compound identifier must not be substituted.
It is method- and report-specific. For example, an HPLC area percentage is not automatically the same as identity, net content, sterility, endotoxin status or absence of elemental impurities.
Follow the exact label, batch CoA and SDS, together with the institution's risk assessment. This page does not provide reconstitution or administration guidance.
No. Human and veterinary use, including ingestion, injection, topical application, diagnosis, treatment, prevention and cosmetic use, is expressly excluded.
RESEARCH USE ONLY. NOT FOR HUMAN OR VETERINARY USE. THE PRODUCT NAME, VIAL AMOUNT AND LITERATURE REFERENCES MUST NOT BE INTERPRETED AS A DOSAGE, ADMINISTRATION INSTRUCTION OR MEDICAL CLAIM.
For analytical, biochemical or non-clinical laboratory research only. Not for human or veterinary use. Not for ingestion, injection, topical application, inhalation, diagnostic, therapeutic, prophylactic or cosmetic use.